Previous Post Next Post
Add to favorites
Copyright: activisionbandai namcocrash bandicoot (series)digimondreamworkshellaversehelluva bosslooney tunesmythologysegasonic (series)sonic the hedgehog (series)super planet dolanthe bad guyswarner brothers
Characters: diane foxingtondigimon (species)gwen geekgwen martinlola bunnyloona (helluva boss)renamonrouge the batshima luantawna bandicoot
Artists: tgtf234
Tags: 8girlsannoyedanthroapartmentapplianceareolabandicootbatbeer bottlebig areolabig breastsbig buttblack hairblack sclerablonde hairblue eyesbottlebreastsbrown eyesbuttcamera flashcanidcanid demoncaninechairclothingcollarconfusioncontainercupcurvy figuredark bodydark furdemondomestic catdrunkeyewearfelidfelinefelisfemalefootwearfoxfridgefurfurnituregenitalsgestureglassesgreen eyesgrouphairhalf-closed eyeshand gesturehellhoundhigh heelsholding containerholding cupholding objecthuge breastskitchen appliancelagomorphleporidmammalmarsupialmousemuridmurinemythological caninemythological creaturenarrowed eyesnipplesnudenudistoffscreen characteropen fridgeorange bodyorange furpartyphone screenpink bodypink furplatform footwearplatform heelspointingpointing at viewerposing for picturerabbitred eyewearred glassesred sclerared solo cuprodentscut tailshoesshort tailshortstacksmilespiked collarspikessubstance intoxicationsurprisedtailtan bodytan furvulvawhite bodywhite furwhite hairwhite sclerawide eyedwings
Meta: 3d3d (artwork)4k9:16absurd resblender (artwork)blender cycles (artwork)crossoverdigital media (artwork)hi res
Uploaded:
0 0 votes
Article Rating
Subscribe
Notify of
guest
0 Comments
Oldest
Newest Most Voted

More like this

Rule 34 – dark-skinned female dark skin female pirates of dark water tagme trdl tula | 358678
6 views
Rule 34 – danny phantom male male only solo tagme vlad masters | 481661
7 views
Rule 34 – 1boy 1boy1girl 1girls 2026 2d (artwork) big ass big breasts big thighs bigger female bleach bleach: the thousand-year blood war breasts breasts bigger than head bully bullying curvaceous curvy curvy figure dat ass digital media (artwork) ekz ekz (robotekz) female femdom high resolution hips hourglass figure huge ass huge breasts huge thighs large ass large breasts large thighs larger female legs light-skinned female light skin male male/female matsumoto rangiku mature mature female school bully school uniform schoolgirl shinigami shorter male shounen jump slim waist smaller male straight tall tall female taller female thick thick hips thick legs thick thighs thighs thighs bigger than head voluptuous waist wide hips | 17953137 /
5 views
Rule 34 – abraham lincoln barry blair beaver breasts commercial deep-sea diver female fur human male mammal mascot nude pale skin penis public domain rodent rozerem sex side view size difference straight tagme what | 358671
12 views
Rule 34 – 1futa 2d 2girls after sex ahe gao ai generated androgyne symbol ass ass balls bench big ass big balls big belly big butt big cock big penis big testicles bike shorts black gloves black shorts blonde hair blue body blue skin blush breasts bridget bridget cock colored skin covered nipples cuffs cuffs (clothing) cum cum on floor cum on ground cum pool cumdrip cumflated cumflated belly cumflation cumshot demon demon futa demon girl demon horns demon tail ejaculating while penetrated ejaculation erection female fingerless gloves fucked silly futa/female futa with female futanari gigantic balls gigantic cock gigantic penis gigantic testicles gloves guilty gear guilty gear strive handsfree ejaculation hood hooded jacket hoodie horns huge balls huge belly huge cock huge cock huge testicles inflation jacket large ass large balls large belly large breasts large butt large cock large penis large testicles large thighs long sleeves massive balls massive cock massive penis massive testicles necktie oni oni female oni futa oni horns onilapper open mouth outdoors penis pointy ears precum projectile cum red eyes rolling eyes sex short hair shorts smile soukaku (zenless zone zero) tail testicles thick ass thick butt thick cock thick penis thick thighs thighs tongue tongue out top-down bottom-up torn clothes trembling uncensored vein veins veiny veiny balls veiny cock veiny penis veiny testicles white hair zenless zone zero | 16402871
21 views