Previous Post Next Post
Add to favorites
Copyright: activisionbandai namcocrash bandicoot (series)digimondreamworkshellaversehelluva bosslooney tunesmythologysegasonic (series)sonic the hedgehog (series)super planet dolanthe bad guyswarner brothers
Characters: diane foxingtondigimon (species)gwen geekgwen martinlola bunnyloona (helluva boss)renamonrouge the batshima luantawna bandicoot
Artists: tgtf234
Tags: 8girlsannoyedanthroapartmentapplianceareolabandicootbatbeer bottlebig areolabig breastsbig buttblack hairblack sclerablonde hairblue eyesbottlebreastsbrown eyesbuttcamera flashcanidcanid demoncaninechairclothingcollarconfusioncontainercupcurvy figuredark bodydark furdemondomestic catdrunkeyewearfelidfelinefelisfemalefootwearfoxfridgefurfurnituregenitalsgestureglassesgreen eyesgrouphairhalf-closed eyeshand gesturehellhoundhigh heelsholding containerholding cupholding objecthuge breastskitchen appliancelagomorphleporidmammalmarsupialmousemuridmurinemythological caninemythological creaturenarrowed eyesnipplesnudenudistoffscreen characteropen fridgeorange bodyorange furpartyphone screenpink bodypink furplatform footwearplatform heelspointingpointing at viewerposing for picturerabbitred eyewearred glassesred sclerared solo cuprodentscut tailshoesshort tailshortstacksmilespiked collarspikessubstance intoxicationsurprisedtailtan bodytan furvulvawhite bodywhite furwhite hairwhite sclerawide eyedwings
Meta: 3d3d (artwork)4k9:16absurd resblender (artwork)blender cycles (artwork)crossoverdigital media (artwork)hi res
Uploaded:
0 0 votes
Article Rating
Subscribe
Notify of
guest
0 Comments
Oldest
Newest Most Voted

More like this

Rule 34 – 2boys anal anal penetration anal sex balls bara big balls big penis bottomless bouncing penis brown hair censored cross cum cum while penetrated dark-skinned male dark skin diphallia diphallism dungeon and fighter dungeon fighter online ejaculation ejaculation while penetrated faceless male facial hair gay huge thighs human human only male male/male male only male penetrated male penetrating male penetrating male male priest (dungeon and fighter) motion lines multi genitalia multi penis multiple boys multiple males muscles muscular naked nude nude male penis pointless censoring priest priest (dungeon and fighter) pubic hair religion sitting on penis thick thighs topwear topwear only unprofessional behavior yamato (artist) yaoi | 673807 /
13 views
Rule 34 – 1girls aegyo sal artist name artist request beauty mark black gloves black shirt blush blush lines blushing breasts brown hair cleavage collarbone colored extremities crop top dark-skinned female dark skin dutch angle fingerless gloves gloves gradient hair green eyes green hair grin halftone highres li’l judd (splatoon) lil judd (splatoon) marina (splatoon) medium breasts mole mole under mouth multicolored hair nintendo octoling one eye closed outstretched hand shirt smile solo splatoon splatoon (series) splatoon 2 tentacle hair very dark skin zipper pull tab | 18945041
4 views
Rule 34 – 1girls absurd res ass blonde hair blush breasts closed mouth commission completely nude from behind green eyes highres kalinka cossack kneeling lips long hair looking at viewer luiiferu medium breasts mega man mega man (classic) nipples nude ocean smile solo very long hair | 18945055
7 views
Rule 34 – 1girls anal anal penetration blonde blonde hair blue eyes bottomless bottomless female detailed background exin female flying spaghetti monster pastafarianism public domain pussy religion vagina vaginal vaginal penetration | 654340 /
10 views
Rule 34 – 1boy anthro balls big penis canine fur furry glowstick kappy male male only penis piercing solo starlight | 596165
11 views